Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Igf2; Igf-2Insulin-like growth factor II; IGF-II; Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin]
Species
Mus musculus(Mouse)
Expression Region
25-91aa
Target Protein Sequence
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Power up your signal transduction research with our Recombinant Mouse Igf2, also known as Insulin-like growth factor II. This protein, expressed in E.coli, is a crucial component in studies of growth regulation, cell survival, and cellular communication.
Our Igf2 is the full length of the mature protein (25-91aa), offering a complete representation of its structure and function. The protein is expressed with a N-terminal 6xHis-tag, ensuring efficient purification and optimal stability. With a purity exceeding 85% as determined by SDS-PAGE, our Recombinant Mouse Igf2 meets the highest standards for precision in scientific research. Choose between a liquid form for immediate experimentation or a lyophilized powder for extended stability, tailoring your research to new heights.